PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P10310_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 207aa    MW: 23408.3 Da    PI: 4.9611
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P10310_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.9e-191871356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           k+++++ +q+++Le+ Fe  ++++ e++ +LA++lgL  rq+ vWFqNrRa++k
  GSMUA_Achr6P10310_001 18 KKRRLSVDQVKALEKDFEVMNKLDPERKVRLAHELGLRPRQIAVWFQNRRARWK 71
                           456899***********************************************9 PP

2HD-ZIP_I/II125.32.7e-4017109193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kkrrls +qvk+LE+ Fe  +kL+perKv+la+eLgl+prq+avWFqnrRAR+ktkqlE+dy aLk+++dalk + ++L+ ++e+L 
  GSMUA_Achr6P10310_001  17 QKKRRLSVDQVKALEKDFEVMNKLDPERKVRLAHELGLRPRQIAVWFQNRRARWKTKQLERDYGALKARHDALKLDVDALRGDKEALM 104
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eelke 93 
                            +e+++
  GSMUA_Achr6P10310_001 105 DEMRA 109
                            99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.75E-181275IPR009057Homeodomain-like
PROSITE profilePS5007116.8271373IPR001356Homeobox domain
SMARTSM003894.2E-171677IPR001356Homeobox domain
CDDcd000864.09E-171774No hitNo description
PfamPF000463.4E-161871IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-192080IPR009057Homeodomain-like
PRINTSPR000312.5E-54453IPR000047Helix-turn-helix motif
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
PRINTSPR000312.5E-55369IPR000047Helix-turn-helix motif
PfamPF021831.4E-1573114IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MEWDDELCSN GSSSLGQKKR RLSVDQVKAL EKDFEVMNKL DPERKVRLAH ELGLRPRQIA  60
VWFQNRRARW KTKQLERDYG ALKARHDALK LDVDALRGDK EALMDEMRAL KAKLADPATP  120
KVEEDGRALG FRDGTSDTDS SAALNEEASP YSGALLDQHH SVLETKSHCS SIFMEEDGFL  180
RGEELCGALF SEEQAPTLPW CCTEGWE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16573RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009404033.11e-152PREDICTED: homeobox-leucine zipper protein HOX20-like
RefseqXP_009404034.11e-152PREDICTED: homeobox-leucine zipper protein HOX20-like
SwissprotQ6Z2485e-52HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
SwissprotA2YWC05e-52HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
TrEMBLM0T5T01e-151M0T5T0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P10310_0011e-151(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.15e-50homeobox protein 16